FedBizOpps banner

Login to begin searching the FBO/CBD
Home Page
CBD/FBO Online
CBD/FBO Email
About Us
Contact Us
Privacy
Categories
No. Notes
Archives
Search
Help
Login
Register

Popular Searches

Popular Categories

Special Order Custom Peptides - Peptide Synthesis SOW/ PWS

General Information

Document Type:SRCSGT
Posted Date:Aug 28, 2017
Category: Research and Development
Set Aside:N/A

Contracting Office Address

Department of the Navy, Bureau of Medicine and Surgery, Naval Medical Research Center, 503 Robert Grant Ave., Contracting Dept, Bldg 500, Silver Spring, Maryland, 20910, United States

Description

PWS/ SOW This solicitation is being issued on an unrestricted basis to allow for full and open competition. The associated NAICS code is 334419. Offerors must also be registered in Systems for Award Management (SAM) at www.sam.gov per FAR 52.212.1 lack of registration in SAM will qualify contractor as ineligible for award. All responsible sources may submit a quotation in response to this solicitationwhich shall be considered.The solicitation is being issued as a Request for Quote (RFQ) for a firm fixed type contract based on the lowest Price Technically Acceptable. The Naval Medical Research Center (NMRC) intends to award a contract resulting from this solicitation to the responsible offeror. all offers must have a DUN & Bradstreet Number. A Dun & Bradstreet number may be acquired free of charge by contacting Dun & Bradstreet online at https://www.dnb.com/products/eupdate/requestOptions.html or by phone at (800) 333-0505. This will be for a Base Year with one Option Year Period. Attached SOW / PWS. Peptide #1 Peptide name: PLA2-1(41-50 aa) Sequence (N to C): KKMTGKSGMLWYSAYGCYCGWGGQGRPKDATDRCCFVHDCCYGKVTGCN Quantity: 5mg HPLC purity: >95% N-terminus: Free C-terminus: Free Modifications: None Aliquots: 5*1mg Salt form: TFA salt Estimated Turnaround Time:4-5 weeks Comment: Customer will accept addition of ddt to prevent oxidation Peptide #2 Peptide name: PLA2-2 (51-60 aa) Sequence (N to C): KKMTGKSGMLWYSAYGCYCGWGGQGRPKDATDRCCFVHDCCYGKVTGCNPKMDIYTY Quantity: 5mg HPLC purity: >95% N-terminus: Free C-terminus: Free Modifications: None Aliquots: 5*1mg Salt form: TFA salt Estimated Turnaround Time: 4-6 weeks Comment: Customer will accept addition of ddt to prevent oxidation

Original Point of Contact

POC Deborah M. Sharpe, Phone: 301-319-6471, LCDR Nicholas Hamlin, Phone: 210-539-6204

Place of Performance

Address:
Naval Medical Research Unit San Antonio, Attn: LCDR Nicholas J. Hamlin, DC, USN, 3400 Rawley E. Chambers, Bldg #3611, JBSA Fort Sam Houston, Texas, 78234, United States
78234,
Link: FBO.gov Permalink
Bookmark This Notice
Print View